PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000710259
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family MYB
Protein Properties Length: 685aa    MW: 76805.6 Da    PI: 8.0631
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000710259genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.72.3e-17490537148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g+WTteEd  lv++++++G+g+W+  ++  g+ R++k+c++rw +yl
    MDP0000710259 490 KGPWTTEEDAMLVNYIQKHGPGNWRNLPKNAGLQRCGKSCRLRWTNYL 537
                      79********************************************97 PP

2Myb_DNA-binding51.13.2e-16543587147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rgr++ eE+e +++++  lG++ W+ Ia++++ gRt++++k++w+++
    MDP0000710259 543 RGRFSFEEEETIIQLHSILGNK-WSGIAARLP-GRTDNEIKNYWNTH 587
                      89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:3.30.559.101.0E-374221IPR023213Chloramphenicol acetyltransferase-like domain
PfamPF024583.2E-3816466IPR003480Transferase
Gene3DG3DSA:3.30.559.101.8E-40253465IPR023213Chloramphenicol acetyltransferase-like domain
Gene3DG3DSA:1.10.10.606.7E-26481540IPR009057Homeodomain-like
PROSITE profilePS5129425.297485541IPR017930Myb domain
SuperFamilySSF466891.46E-30487584IPR009057Homeodomain-like
SMARTSM007174.5E-14489539IPR001005SANT/Myb domain
PfamPF002491.9E-15490537IPR001005SANT/Myb domain
CDDcd001671.21E-11492537No hitNo description
Gene3DG3DSA:1.10.10.603.2E-25541592IPR009057Homeodomain-like
PROSITE profilePS5129420.389542592IPR017930Myb domain
SMARTSM007171.0E-15542590IPR001005SANT/Myb domain
PfamPF002491.6E-14543587IPR001005SANT/Myb domain
CDDcd001673.03E-11545588No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0016747Molecular Functiontransferase activity, transferring acyl groups other than amino-acyl groups
Sequence ? help Back to Top
Protein Sequence    Length: 685 aa     Download sequence    Send to blast
MASTLKVLEQ CQVSPPKDSV PTTSLPLTFL DIPWLVLXQP VQRLYFYEFP HPSHHFTQTL  60
LPSIKHTLSL TLQNFFPLSG NLTCPPPPSM PYIHYVANMS SVKFTITESA ANFIHLIGNH  120
PRHVQEFDHL VPHLPDFXNL DSNSSDTTTF LLPILALQAT IFPNSGLCIS IAYRHVVDGR  180
TANHFMKCWA SVYKSGGDLS CIHESPPIYD RDLIKTPKDY EPILFNQYIG LRSTWKNLDM  240
AKSSSIFIDN FRTTFVLGRE NIQSLKQLIM TQCKNCNEPT PKHLSKFVVT CGFVWVCLMK  300
ALHASETGVT SMKDDDLLRL GFAADIRSLF QNPVPITYFG NCLSACYVAD KKREIMAECG  360
IAKAVKALEA AIFELKNRDL EGLKRMVPFR GELVVAESSV AIAGSPKLGV YGTDFGWGRA  420
KKVEVVHFVD STVFSLAESR DEEDGIEVGL ALPRTTMDAF TSLFEQDNST SCATNNMGRA  480
PCCDKNGLKK GPWTTEEDAM LVNYIQKHGP GNWRNLPKNA GLQRCGKSCR LRWTNYLRPD  540
IKRGRFSFEE EETIIQLHSI LGNKWSGIAA RLPGRTDNEI KNYWNTHIRK RLLRMGIDPV  600
THAPRIDLLD LSSILSSYVC NNPXAALLNL SNLLNSTQQQ QPLVNPELLR LATSLLSIKQ  660
ENPELCPQNY SPLQKPDLQF SGTK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2xr7_A1e-8174644446MALONYLTRANSFERASE
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.162590.0bud
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ0744660.0DQ074466.1 Malus x domestica MYB18 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008379902.10.0PREDICTED: coumaroyl-CoA:anthocyanidin 3-O-glucoside-6''-O-coumaroyltransferase 1-like
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G21440.13e-85MYB-like 102